PDB entry 2gp6

View 2gp6 on RCSB PDB site
Description: X-ray crystal structure of Mycobacterium tuberculosis beta-ketoacyl acyl carrier protein synthase II (mtKasB)
Class: transferase
Keywords: thiolase fold, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2006-04-17, released 2006-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: kasB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63456 (21-433)
      • cloning artifact (19-20)
    Domains in SCOPe 2.07: d2gp6a1, d2gp6a2, d2gp6a3
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: kasB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63456 (21-433)
      • cloning artifact (19-20)
    Domains in SCOPe 2.07: d2gp6b1, d2gp6b2, d2gp6b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gp6A (A:)
    mgsshhhhhhssglvprgshmvtgkafpyvvvtgiamttalatdaettwkllldrqsgir
    tlddpfveefdlpvrigghlleefdhqltrielrrmgylqrmstvlsrrlwenagspevd
    tnrlmvsigtglgsaeelvfsyddmrargmkavspltvqkympngaaaavglerhakagv
    mtpvsacasgaeaiarawqqivlgeadaaicggvetrieavpiagfaqmrivmstnnddp
    agacrpfdrdrdgfvfgeggalllieteehakarganilarimgasitsdgfhmvapdpn
    geraghaitraiqlaglapgdidhvnahatgtqvgdlaegrainnalggnrpavyapksa
    lghsvgavgavesiltvlalrdqvipptlnlvnldpeidldvvageprpgnyryainnsf
    gfgghnvaiafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gp6A (A:)
    hmvtgkafpyvvvtgiamttalatdaettwkllldrqsgirtlddpfveefdlpvriggh
    lleefdhqltrielrrmgylqrmstvlsrrlwenagspevdtnrlmvsigtglgsaeelv
    fsyddmrargmkavspltvqkympngaaaavglerhakagvmtpvsacasgaeaiarawq
    qivlgeadaaicggvetrieavpiagfaqmrivmstnnddpagacrpfdrdrdgfvfgeg
    galllieteehakarganilarimgasitsdgfhmvapdpngeraghaitraiqlaglap
    gdidhvnahatgtqvgdlaegrainnalggnrpavyapksalghsvgavgavesiltvla
    lrdqvipptlnlvnldpeidldvvageprpgnyryainnsfgfgghnvaiafgry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gp6B (B:)
    mgsshhhhhhssglvprgshmvtgkafpyvvvtgiamttalatdaettwkllldrqsgir
    tlddpfveefdlpvrigghlleefdhqltrielrrmgylqrmstvlsrrlwenagspevd
    tnrlmvsigtglgsaeelvfsyddmrargmkavspltvqkympngaaaavglerhakagv
    mtpvsacasgaeaiarawqqivlgeadaaicggvetrieavpiagfaqmrivmstnnddp
    agacrpfdrdrdgfvfgeggalllieteehakarganilarimgasitsdgfhmvapdpn
    geraghaitraiqlaglapgdidhvnahatgtqvgdlaegrainnalggnrpavyapksa
    lghsvgavgavesiltvlalrdqvipptlnlvnldpeidldvvageprpgnyryainnsf
    gfgghnvaiafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gp6B (B:)
    hmvtgkafpyvvvtgiamttalatdaettwkllldrqsgirtlddpfveefdlpvriggh
    lleefdhqltrielrrmgylqrmstvlsrrlwenagspevdtnrlmvsigtglgsaeelv
    fsyddmrargmkavspltvqkympngaaaavglerhakagvmtpvsacasgaeaiarawq
    qivlgeadaaicggvetrieavpiagfaqmrivmstnnddpagacrpfdrdrdgfvfgeg
    galllieteehakarganilarimgasitsdgfhmvapdpngeraghaitraiqlaglap
    gdidhvnahatgtqvgdlaegrainnalggnrpavyapksalghsvgavgavesiltvla
    lrdqvipptlnlvnldpeidldvvageprpgnyryainnsfgfgghnvaiafgry