PDB entry 2go8

View 2go8 on RCSB PDB site
Description: Crystal structure of YQJZ_BACSU FROM Bacillus subtilis. Northeast structural genomics TARGET SR435
Class: structural genomics, unknown function
Keywords: SR435, protein structure, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-04-12, released 2006-04-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein yqjZ
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yqjZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54563
    • modified residue (35)
    • modified residue (67)
  Domains in SCOPe 2.01: d2go8a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2go8A (A:)
  mmdflsktpeppyyavifssvksendtgygetaermvslaadqpgflgvesvreadgrgi
  tvsywdsmdainhwrhhtehqaakekgrsvwyesyavrvakvdrqrlfqentndlehhhh
  hh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2go8A (A:)
  dflsktpeppyyavifssvksgetaermvslaadqpgflgvesvreadgrgitvsywdsm
  dainhwrhhtyesyavrvakvdrqrlfqe