PDB entry 2go8

View 2go8 on RCSB PDB site
Description: Crystal structure of YQJZ_BACSU FROM Bacillus subtilis. Northeast structural genomics TARGET SR435
Class: structural genomics, unknown function
Keywords: SR435, protein structure, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-04-12, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yqjZ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yqjZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54563
      • modified residue (35)
      • modified residue (67)
    Domains in SCOPe 2.08: d2go8a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2go8A (A:)
    mmdflsktpeppyyavifssvksendtgygetaermvslaadqpgflgvesvreadgrgi
    tvsywdsmdainhwrhhtehqaakekgrsvwyesyavrvakvdrqrlfqentndlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2go8A (A:)
    dflsktpeppyyavifssvksgetaermvslaadqpgflgvesvreadgrgitvsywdsm
    dainhwrhhtyesyavrvakvdrqrlfqe