PDB entry 2go5

View 2go5 on RCSB PDB site
Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex
Class: translation/RNA
Keywords: sr, srp, ribosome, translation/RNA complex
Deposited on 2006-04-12, released 2006-06-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 7.4 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Signal recognition particle receptor alpha subunit (SR a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08240 (11-End)
      • expression tag (7)
      • cloning artifact (8-10)
    Domains in SCOPe 2.01: d2go511
  • Chain '2':
    Compound: Signal recognition particle receptor beta subunit (SR b)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2go521
  • Chain '4':
    Compound: ribosomal protein l23
    Species: Triticum sp. [TaxId:4569]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GO5
  • Chain '5':
    Compound: ribosomal protein L35
    Species: Triticum sp. [TaxId:4569]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: ribosomal protein L31
    Species: Triticum sp. [TaxId:4569]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GO5
  • Chain '9':
    Compound: ribosomal RNA
    Species: Triticum sp. [TaxId:4569]
  • Chain 'A':
    Compound: srp RNA
    Species: Canis sp. [TaxId:9616]
  • Chain 'B':
    Compound: Signal recognition particle 19 kDa protein (SRP19)
    Species: Canis sp. [TaxId:9616]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GO5 (Start-107)
    Domains in SCOPe 2.01: d2go5b1
  • Chain 'W':
    Compound: Signal recognition particle 54 kDa protein (SRP54)
    Species: Canis sp. [TaxId:9616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2go5w1

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2go51 (1:)
    mshhhhhhsmvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqerggnnsfthea
    ltlkykldnqfelvfvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtf
    dfqndflrllreaeesskirapttmkkfedsekakkpvrsmietrgekpkekaknskkkg
    akkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2go51 (1:)
    hsmvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqethealtlkykldnqfelv
    fvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrllreae
    esski
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2go52 (2:)
    markssqravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlid
    lpgheslrfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslli
    acnkqdiamaksakliqqqlekelntlrvtrsaapstldssstapaqlgkkgkefefsql
    plkveflecsakggrgdtgsadiqdlekwlakia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2go52 (2:)
    ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
    rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
    amaksakliqqqlekelntlrvtrspaqlgkkgkefefsqlplkveflecsaksadiqdl
    ekwlakia
    

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2go5B (B:)
    mrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrew
    nrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2go5B (B:)
    rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
    rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2go5W (W:)
    qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
    eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkm