PDB entry 2go2

View 2go2 on RCSB PDB site
Description: Crystal structure of BbKI, a Kunitz-type kallikrein inhibitor
Class: protein binding
Keywords: beta-trefoil fold, protein binding
Deposited on 2006-04-12, released 2007-03-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz-type serine protease inhibitor BbKI
    Species: Bauhinia bauhinioides [TaxId:166014]
    Gene: BbKI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83052 (1-162)
      • cloning artifact (0)
    Domains in SCOPe 2.04: d2go2a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2go2A (A:)
    ssvvvdtngqpvsngadayylvpvshghaglalakigneaepravvldphhrpglpvrfe
    splriniikesyflnikfgpsssdsgvwdviqqdpiglavkvtdtksllgpfkvekegeg
    ykivyypergqtgldiglvhrndkyylavkdgepcvfkirkat