PDB entry 2gnx

View 2gnx on RCSB PDB site
Description: X-ray structure of a hypothetical protein from Mouse Mm.209172
Class: structural genomics, unknown function
Keywords: structural genomics, protein structure initiative, psi, center for eukaryotic structural genomics, cesg, unknown function
Deposited on 2006-04-11, released 2006-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.281
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Mus musculus [TaxId:10090]
    Gene: Mm209172, BC065058
    Database cross-references and differences (RAF-indexed):
    • GB NP_766610 (21-End)
      • modified residue (35)
      • modified residue (44)
      • modified residue (157)
      • modified residue (162)
      • modified residue (184)
      • modified residue (257)
      • modified residue (264)
      • modified residue (266)
    Domains in SCOPe 2.06: d2gnxa1, d2gnxa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gnxA (A:)
    xxxxxxxxxxxxxxxxxxxxxphlseqlcffvqarmeiadfyekmyalstqkfinteelv
    stldtilrkyssrfhhpilsplessfqlevgvlshllkaqaqisewkflpslvtlhnaht
    klqswgqtfekqretkkhlfggqsqkavqpphlflwlmklktmllakfsfyfhealsrqt
    tasemkaltakanpdlfgkissfirkydaanvslifdnrgsesfqghgyhhphsyreapk
    gvdqypavvslpsdrpvmhwpnvimimtdrasdlnslekvvhfyddkvqstyfltrpeph
    ftivvifeskkserdshfisflnelslalknpkvfaslkpgskg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gnxA (A:)
    xxxxxxxxxxxxxxxxxxxxxphlseqlcffvqarmeiadfyekmyalstqkfinteelv
    stldtilrkysplessfqlevgvlshllkaqaqisewkflpslvtlhnahtklqswgqtf
    ekqrpphlflwlmklktmllakfsfyfhealsrqttasemkaltakanpdlfgkissfir
    kydaanvslifdqypavvslpsdrpvmhwpnvimimtdrasdlnslekvvhfyddkvqst
    yfltrpephftivvifeskkserdshfisflnelslalknpkvfaslk