PDB entry 2gnw

View 2gnw on RCSB PDB site
Description: Crystal structure of non-symbiotic plant hemoglobin from rice, B10 mutant F40W
Class: oxygen storage/transport
Keywords: 2 on 2 helical fold, globin, heme, iron, hemoglobin, hexacoordinate, nonsymbiotic, rice, oxygen storage/transport complex
Deposited on 2006-04-11, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-symbiotic hemoglobin 1
    Species: Oryza sativa [TaxId:4530]
    Gene: HB1, GLB1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04986 (0-164)
      • engineered (39)
    Domains in SCOPe 2.07: d2gnwa_
  • Chain 'B':
    Compound: Non-symbiotic hemoglobin 1
    Species: Oryza sativa [TaxId:4530]
    Gene: HB1, GLB1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04986 (0-164)
      • engineered (39)
    Domains in SCOPe 2.07: d2gnwb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gnwA (A:)
    alvednnavavsfseeqealvlkswailkkdsanialrfwlkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gnwB (B:)
    alvednnavavsfseeqealvlkswailkkdsanialrfwlkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae