PDB entry 2gnv

View 2gnv on RCSB PDB site
Description: Crystal structure of non-symbiotic plant hemoglobin from rice, B10 mutant F40L
Class: oxygen storage/transport
Keywords: 2 on 2 helical fold, globin, heme, iron, hemoglobin, hexacoordinate, nonsymbiotic, rice, oxygen storage-transport complex
Deposited on 2006-04-11, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-symbiotic hemoglobin 1
    Species: Oryza sativa [TaxId:4530]
    Gene: HB1, GLB1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04986 (Start-164)
      • engineered (39)
    Domains in SCOPe 2.07: d2gnva_
  • Chain 'B':
    Compound: Non-symbiotic hemoglobin 1
    Species: Oryza sativa [TaxId:4530]
    Gene: HB1, GLB1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04986 (Start-164)
      • engineered (39)
    Domains in SCOPe 2.07: d2gnvb_
  • Heterogens: HEM, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gnvA (A:)
    alvednnavavsfseeqealvlkswailkkdsanialrfllkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gnvA (A:)
    avavsfseeqealvlkswailkkdsanialrfllkifevapsasqmfsflrnsdvplekn
    pklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfevvkfalld
    tikeevpadmwspamksawseaydhlvaaikqemkpae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gnvB (B:)
    alvednnavavsfseeqealvlkswailkkdsanialrfllkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gnvB (B:)
    vsfseeqealvlkswailkkdsanialrfllkifevapsasqmfsflrnsdvpleknpkl
    kthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfevvkfalldtik
    eevpadmwspamksawseaydhlvaaikqemkpae