PDB entry 2gnt

View 2gnt on RCSB PDB site
Description: EDTA treated P. angolensis lectin (PAL) remetallized with calcium (1 hour treatment)
Class: sugar binding protein
Keywords: legume lectin, remetallization, PAL, metal binding, beta sandwich, SUGAR BINDING PROTEIN
Deposited on 2006-04-11, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pterocarpus angolensis [TaxId:182271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gnta_
  • Chain 'B':
    Compound: lectin
    Species: Pterocarpus angolensis [TaxId:182271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gntb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gntA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gntA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gntB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gntB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt