PDB entry 2gno

View 2gno on RCSB PDB site
Description: Crystal structure of a dna polymerase iii, gamma subunit-related protein (tm0771) from thermotoga maritima msb8 at 2.00 A resolution
Class: replication
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, replication
Deposited on 2006-04-10, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III, gamma subunit-related protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0771
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZM9
      • modified residue (93)
      • modified residue (183)
      • modified residue (287)
    Domains in SCOPe 2.07: d2gnoa1, d2gnoa2
  • Heterogens: NA, UNL, ETX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gnoA (A:)
    gakdqletlkriieksegisilingedlsyprevslelpeyvekfppkasdvleidpege
    nigiddirtikdflnyspelytrkyvivhdcermtqqaanaflkaleeppeyavivlntr
    rwhyllptiksrvfrvvvnvpkefrdlvkekigdlweelpllerdfktaleayklgaekl
    sglmeslkvletekllkkvlskglegylacrellerfskveskeffalfdqvtntitgkd
    aflliqrltriilhentwesvedqksvsfldsilrvkianlnnkltlmnilaihrerkrg
    vnaws
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gnoA (A:)
    dqletlkriieksegisilingedlsyprevslelpeyvekfppkasdvleidpegenig
    iddirtikdflnyspelytrkyvivhdcermtqqaanaflkaleeppeyavivlntrrwh
    yllptiksrvfrvvvnvpkefrdlvkekigdlweelpllerdfktaleayklgaeklsgl
    meslkvletekllkkvlskglegylacrellerfskveskeffalfdqvtntitgkdafl
    liqrltriilhentwesvedqksvsfldsilrvkianlnnkltlmnilaihrerkr