PDB entry 2gnm

View 2gnm on RCSB PDB site
Description: P. angolensis lectin (PAL) treated with EDTA for 39 hours
Class: sugar binding protein
Keywords: legume lectin, metal-free lectin, EDTA treatment, PAL, sugar complex, mannose, beta sandwich, SUGAR BINDING PROTEIN
Deposited on 2006-04-10, released 2006-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pterocarpus angolensis [TaxId:182271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GSD2 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d2gnma_
  • Chain 'B':
    Compound: lectin
    Species: Pterocarpus angolensis [TaxId:182271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GSD2 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d2gnmb_
  • Heterogens: MAN, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gnmA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gnmA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gnmB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gnmB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpstr
    nldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyta