PDB entry 2gnc

View 2gnc on RCSB PDB site
Description: Crystal structure of srGAP1 SH3 domain in the slit-robo signaling pathway
Class: signaling protein
Keywords: beta barrel, signaling protein
Deposited on 2006-04-10, released 2006-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SLIT-ROBO Rho GTPase-activating protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91Z69 (8-59)
      • cloning artifact (5-7)
    Domains in SCOPe 2.06: d2gnca1, d2gnca2
  • Chain 'B':
    Compound: SLIT-ROBO Rho GTPase-activating protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91Z69 (8-59)
      • cloning artifact (5-7)
    Domains in SCOPe 2.06: d2gncb1, d2gncb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gncA (A:)
    gplgspefaiakfdyvgrsarelsfkkgaslllyhrasedwwegrhngidglvphqyivv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gncA (A:)
    pefaiakfdyvgrsarelsfkkgaslllyhrasedwwegrhngidglvphqyivv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gncB (B:)
    gplgspefaiakfdyvgrsarelsfkkgaslllyhrasedwwegrhngidglvphqyivv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gncB (B:)
    pefaiakfdyvgrsarelsfkkgaslllyhrasedwwegrhngidglvphqyivv