PDB entry 2gn5

View 2gn5 on RCSB PDB site
Description: refined structure of the gene 5 DNA binding protein from bacteriophage fd
Class: DNA binding (viral)
Keywords: DNA binding (viral)
Deposited on 1986-01-13, released 1986-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: -1.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene v protein
    Species: Enterobacteria phage M13 [TaxId:10870]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gn5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gn5A (A:)
    mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
    ytvhlssfkvgqfgslmidrlrlvpak