PDB entry 2gmy

View 2gmy on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD
Class: structural genomics, unknown function
Keywords: Agrobacterium tumefaciens, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-04-07, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Atu0492
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: GI:17934405
    Database cross-references and differences (RAF-indexed):
    • GB AAL41511
    Domains in SCOPe 2.07: d2gmya1
  • Chain 'B':
    Compound: Hypothetical protein Atu0492
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: GI:17934405
    Database cross-references and differences (RAF-indexed):
    • GB AAL41511 (0-End)
    Domains in SCOPe 2.07: d2gmyb_
  • Chain 'C':
    Compound: Hypothetical protein Atu0492
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: GI:17934405
    Database cross-references and differences (RAF-indexed):
    • GB AAL41511
    Domains in SCOPe 2.07: d2gmyc_
  • Chain 'D':
    Compound: Hypothetical protein Atu0492
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: GI:17934405
    Database cross-references and differences (RAF-indexed):
    • GB AAL41511
    Domains in SCOPe 2.07: d2gmyd_
  • Chain 'E':
    Compound: Hypothetical protein Atu0492
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: GI:17934405
    Database cross-references and differences (RAF-indexed):
    • GB AAL41511
    Domains in SCOPe 2.07: d2gmye_
  • Chain 'F':
    Compound: Hypothetical protein Atu0492
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: GI:17934405
    Database cross-references and differences (RAF-indexed):
    • GB AAL41511
    Domains in SCOPe 2.07: d2gmyf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gmyA (A:)
    mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesr
    hdglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeei
    vkitvaigaintwnriavgfrsqhpveaaakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmyA (A:)
    ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
    dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
    kitvaigaintwnriavgfrsqhpvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gmyB (B:)
    mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesr
    hdglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeei
    vkitvaigaintwnriavgfrsqhpveaaakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmyB (B:)
    mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesr
    hdglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeei
    vkitvaigaintwnriavgfrsqhpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gmyC (C:)
    mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesr
    hdglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeei
    vkitvaigaintwnriavgfrsqhpveaaakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmyC (C:)
    ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
    dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
    kitvaigaintwnriavgfrsqhpve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gmyD (D:)
    mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesr
    hdglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeei
    vkitvaigaintwnriavgfrsqhpveaaakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmyD (D:)
    ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
    dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
    kitvaigaintwnriavgfrsqhpv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gmyE (E:)
    mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesr
    hdglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeei
    vkitvaigaintwnriavgfrsqhpveaaakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmyE (E:)
    ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
    dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
    kitvaigaintwnriavgfrsqhpv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gmyF (F:)
    mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesr
    hdglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeei
    vkitvaigaintwnriavgfrsqhpveaaakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmyF (F:)
    ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
    dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
    kitvaigaintwnriavgfrsqhpvea