PDB entry 2gmt

View 2gmt on RCSB PDB site
Description: three-dimensional structure of chymotrypsin inactivated with (2s) n-acetyl-l-alanyl-l-phenylalanyl-chloroethyl ketone: implications for the mechanism of inactivation of serine proteases by chloroketones
Deposited on 1994-09-07, released 1994-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2gmt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2gmt_ (-)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmt_ (-)
    cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
    vvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclps
    asddfaagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgvs
    scmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan