PDB entry 2gmq

View 2gmq on RCSB PDB site
Description: Crystal structure of protein EF0006 from Enterococcus faecalis
Class: structural genomics, unknown function
Keywords: Enterococcus faecalis, Hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-04-07, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein EF0006
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82YS4
      • modified residue (12)
      • modified residue (44)
      • modified residue (46)
    Domains in SCOPe 2.07: d2gmqa1
  • Chain 'B':
    Compound: Hypothetical protein EF0006
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82YS4
      • modified residue (12)
      • modified residue (44)
      • modified residue (46)
    Domains in SCOPe 2.07: d2gmqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2gmqA (A:)
meavvvereakgmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqe
ittlniikngkslalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifgetlka

    Sequence, based on observed residues (ATOM records): (download) 
    >2gmqA (A:)
gmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngk
slalevypeksiyvkprinvpvffiktpinrgvfeeifg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2gmqB (B:)
meavvvereakgmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqe
ittlniikngkslalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifgetlka

    Sequence, based on observed residues (ATOM records): (download) 
    >2gmqB (B:)
mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks
lalevypeksiyvkpgrinvpvffiktpinrgvfeeifg