PDB entry 2gmp

View 2gmp on RCSB PDB site
Description: Metal-free (apo) P. angolensis seed lectin in complex with GlcNAC-beta(1-2)Man
Class: sugar binding protein
Keywords: legume lectin, metal-free lectin, sugar complex, GlcNAc-beta(1-2)Man, beta sandwich
Deposited on 2006-04-07, released 2006-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pterocarpus angolensis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GSD2 (0-End)
      • modified residue (0)
    Domains in SCOP 1.73: d2gmpa1
  • Chain 'B':
    Compound: lectin
    Species: Pterocarpus angolensis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GSD2 (0-End)
      • modified residue (0)
    Domains in SCOP 1.73: d2gmpb1
  • Heterogens: NAG, MAN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gmpA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmpA (A:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapnqviave
    fdtfysntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpstrnldvvatysd
    gtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstlly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gmpB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    aqkkgenlalem
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmpB (B:)
    edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgnqviav
    efdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpstrnldvva
    tysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt