PDB entry 2gmo

View 2gmo on RCSB PDB site
Description: NMR-structure of an independently folded C-terminal domain of influenza polymerase subunit PB2
Class: viral protein
Keywords: compact beta-structure, VIRAL PROTEIN
Deposited on 2006-04-07, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase basic protein 2
    Species: Influenza A virus (A/Victoria/3/1975(H3N2)) [TaxId:392809]
    Gene: pb2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gmoa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2gmoA (A:)
gdpdestsgvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmk
rkrdssiltdsqtatkrirmain

    Sequence, based on observed residues (ATOM records): (download) 
    >2gmoA (A:)
gvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssil
tdsqtatkrirmain