PDB entry 2gmn

View 2gmn on RCSB PDB site
Description: Crystal structure of BJP-1, a subclass B3 metallo-beta-lactamase of Bradyrhizobium japonicum
Class: hydrolase
Keywords: metallo-beta-lactamase, HYDROLASE
Deposited on 2006-04-07, released 2007-04-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.18
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Database cross-references and differences (RAF-indexed):
    • GB NP_772870
    Domains in SCOPe 2.05: d2gmna1
  • Chain 'B':
    Compound: metallo-beta-lactamase
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Database cross-references and differences (RAF-indexed):
    • GB NP_772870
    Domains in SCOPe 2.05: d2gmnb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gmnA (A:)
    qtikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmi
    kdniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgde
    knedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlff
    csgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgap
    npfikpgelvtyatslsedfdkqlakqtaalekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmnA (A:)
    vamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklg
    fkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafp
    avkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvaln
    rlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpge
    lvtyatslsedfdkqlakqtaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gmnB (B:)
    qtikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmi
    kdniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgde
    knedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlff
    csgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgap
    npfikpgelvtyatslsedfdkqlakqtaalekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmnB (B:)
    vamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklg
    fkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafp
    avkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvaln
    rlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpge
    lvtyatslsedfdkqlakqtaale