PDB entry 2gmk

View 2gmk on RCSB PDB site
Description: Crystal structure of onconase double mutant with spontaneously-assembled (AMP) 4 stack
Class: hydrolase
Keywords: Onconase, P-30 protein, ribonuclease, anti-tumor, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE
Deposited on 2006-04-06, released 2006-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.165
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P-30 protein
    Species: Rana pipiens [TaxId:8404]
    Gene: RNP30_RANPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22069 (0-103)
      • modified residue (0)
      • engineered (88)
      • engineered (90)
    Domains in SCOPe 2.02: d2gmka_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gmkA (A:)
    edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
    sefylsdcnvtsrpckyklkkstnkfcvncanqapvhfvgvgsc