PDB entry 2gm9

View 2gm9 on RCSB PDB site
Description: Structure of rabbit muscle glycogen phosphorylase in complex with thienopyrrole
Class: transferase
Keywords: glycogen phosphorylase, transferase
Deposited on 2006-04-06, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gm9a_
  • Heterogens: PLR, 3TH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gm9A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
    ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
    caytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
    eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
    lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
    eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaap
    gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
    easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
    ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
    knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm9A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapng
    gyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksnfdafpd
    kvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvhl
    letllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsha
    vngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeey
    isdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkrih
    eykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvn
    hdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigt
    mdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffs
    pkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkf
    ssdrtiaqyareiwgvepsrqrlpa