PDB entry 2gm4

View 2gm4 on RCSB PDB site
Description: An activated, tetrameric gamma-delta resolvase: Hin chimaera bound to cleaved DNA
Class: recombination, DNA
Keywords: Gamma delta resolvase, Protein DNA complex, site specific recombination, RECOMBINATION, DNA
Deposited on 2006-04-05, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.282
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transposon gamma-delta resolvase
    Species: Escherichia coli [TaxId:562]
    Gene: TNPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03012 (0-182)
      • engineered (1)
      • engineered (55)
      • engineered (95)
      • engineered (97)
      • engineered (99-101)
      • engineered (104)
      • engineered (123)
    Domains in SCOPe 2.06: d2gm4a1, d2gm4a2
  • Chain 'B':
    Compound: transposon gamma-delta resolvase
    Species: Escherichia coli [TaxId:562]
    Gene: TNPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03012 (Start-182)
      • engineered (1)
      • engineered (55)
      • engineered (95)
      • engineered (97)
      • engineered (99-101)
      • engineered (104)
      • engineered (123)
    Domains in SCOPe 2.06: d2gm4b1, d2gm4b2
  • Chain 'I':
    Compound: 5'-d(*cp*ap*gp*tp*gp*tp*cp*cp*gp*ap*tp*ap*ap*tp*tp*tp*ap*tp*ap*ap*a)-3'
  • Chain 'J':
    Compound: 5'-d(*cp*ap*gp*tp*gp*tp*cp*cp*gp*ap*tp*ap*ap*tp*tp*tp*ap*tp*ap*ap*a)-3'
  • Chain 'K':
    Compound: 5'-d(*tp*tp*ap*tp*cp*gp*gp*ap*cp*ap*cp*tp*g)-3'
  • Chain 'X':
    Compound: 5'-d(*cp*ap*gp*tp*gp*tp*cp*cp*gp*ap*tp*ap*ap*tp*tp*tp*ap*tp*ap*ap*a)-3'
  • Chain 'Y':
    Compound: 5'-d(*tp*tp*ap*tp*cp*gp*gp*ap*cp*ap*cp*tp*g)-3'
  • Chain 'Z':
    Compound: 5'-d(*cp*ap*gp*tp*gp*tp*cp*cp*gp*ap*tp*ap*ap*tp*tp*tp*ap*tp*ap*ap*a)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gm4A (A:)
    malfgyarvstsqqsldiqvralkdagvkanriftdkasgsssdrkgldllrmkvkegdv
    ilvkkldrlgrdtadmiqlikefdaqgvsirfiddsidtssamgrmvvtilsavaqaerq
    rilqrtnegrqeamakgvvfgrkrkidrdavlnmwqqglgashisktmniarstvykvin
    esn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm4A (A:)
    malfgyarvstsqqsldiqvralkdagvkanriftdkasdrkgldllrmkvkegdvilvk
    kldrlgrdtadmiqlikefdaqgvsirfiddsidtssamgrmvvtilsavaqaerqrilq
    rtnegrqeamakgvvfgrkrkidrdavlnmwqqglgashisktmniarstvykvinesn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gm4B (B:)
    malfgyarvstsqqsldiqvralkdagvkanriftdkasgsssdrkgldllrmkvkegdv
    ilvkkldrlgrdtadmiqlikefdaqgvsirfiddsidtssamgrmvvtilsavaqaerq
    rilqrtnegrqeamakgvvfgrkrkidrdavlnmwqqglgashisktmniarstvykvin
    esn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm4B (B:)
    alfgyarvstsqqsldiqvralkdagvkanriftdkasdrkgldllrmkvkegdvilvkk
    ldrlgrdtadmiqlikefdaqgvsirfiddsidtssamgrmvvtilsavaqaerqrilqr
    tnegrqeamakgvvfgrkrkidrdavlnmwqqglgashisktmniarstvykvinesn
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.