PDB entry 2gm3

View 2gm3 on RCSB PDB site
Description: Crystal Structure of an Universal Stress Protein Family Protein from Arabidopsis Thaliana At3g01520 with AMP Bound
Class: structural genomics, unknown function
Keywords: At3g01520, putative ethylene-responsive protein, USP Domain, nucleotide binding domain, AMP, PROTEIN STRUCTURE INITIATIVE, PSI, CENTER FOR EUKARYOTIC STRUCTURAL GENOMICS, CESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2006-04-05, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g01520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGG8 (Start-174)
      • modified residue (8)
      • modified residue (76)
      • modified residue (158)
    Domains in SCOPe 2.07: d2gm3a1
  • Chain 'B':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g01520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGG8
      • modified residue (8)
      • modified residue (76)
      • modified residue (158)
    Domains in SCOPe 2.07: d2gm3b_
  • Chain 'C':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g01520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGG8 (Start-174)
      • modified residue (8)
      • modified residue (76)
      • modified residue (158)
    Domains in SCOPe 2.07: d2gm3c_
  • Chain 'D':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g01520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGG8 (Start-174)
      • modified residue (8)
      • modified residue (76)
      • modified residue (158)
    Domains in SCOPe 2.07: d2gm3d_
  • Chain 'E':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g01520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGG8 (Start-174)
      • modified residue (8)
      • modified residue (76)
      • modified residue (158)
    Domains in SCOPe 2.07: d2gm3e_
  • Chain 'F':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g01520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGG8 (Start-174)
      • modified residue (8)
      • modified residue (76)
      • modified residue (158)
    Domains in SCOPe 2.07: d2gm3f_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gm3A (A:)
    sgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedg
    fddvdsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqev
    krvrpdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm3A (A:)
    ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
    rdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrg
    lgtvsafcvkhaecpvmtikrnadetpsdpadd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gm3B (B:)
    sgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedg
    fddvdsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqev
    krvrpdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm3B (B:)
    ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
    rdmglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrglgtvsaf
    cvkhaecpvmtikrnadetpsdpad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gm3C (C:)
    sgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedg
    fddvdsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqev
    krvrpdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm3C (C:)
    ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
    rdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrg
    lgtvsafcvkhaecpvmtikrnadetpsdpadd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gm3D (D:)
    sgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedg
    fddvdsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqev
    krvrpdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm3D (D:)
    ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
    rdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrg
    lgtvsafcvkhaecpvmtikrnadetpsdpadd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gm3E (E:)
    sgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedg
    fddvdsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqev
    krvrpdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm3E (E:)
    ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
    rdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrg
    lgtvsafcvkhaecpvmtikrnadetpsdpadd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gm3F (F:)
    sgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedg
    fddvdsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqev
    krvrpdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm3F (F:)
    ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
    rdmrqglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrglgtvs
    afcvkhaecpvmtikrnadetpsdpadd