PDB entry 2gm1

View 2gm1 on RCSB PDB site
Description: Crystal structure of the mitotic kinesin eg5 in complex with mg-adp and n-(3-aminopropyl)-n-((3-benzyl-5-chloro-4-oxo-3,4-dihydropyrrolo[2,1-f][1,2,4]triazin-2-yl)(cyclopropyl)methyl)-4-methylbenzamide
Class: Cell Cycle
Keywords: Eg5 Mg-ADP Complex Inhibitor
Deposited on 2006-04-05, released 2006-06-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin-related motor protein eg5
    Species: HOMO SAPIENS
    Gene: EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gm1a1
  • Chain 'B':
    Compound: kinesin-related motor protein eg5
    Species: HOMO SAPIENS
    Gene: EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gm1b1
  • Chain 'D':
    Compound: kinesin-related motor protein eg5
    Species: HOMO SAPIENS
    Gene: EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gm1d1
  • Chain 'E':
    Compound: kinesin-related motor protein eg5
    Species: HOMO SAPIENS
    Gene: EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gm1e1
  • Heterogens: MG, 2AZ, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gm1A (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm1A (A:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtgglkssrktytfdmvfgastkq
    idvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiipr
    tlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikg
    leeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkevkigklnlvdl
    agsenigrinqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispa
    slnleetlstleyahraknilnkpevnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gm1B (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm1B (B:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
    kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
    prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
    kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkvkigklnlvd
    lagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispasl
    nleetlstleyahraknilnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gm1D (D:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm1D (D:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtgglkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkvkigklnlvdl
    agseninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispasln
    leetlstleyahraknilnkpevnq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gm1E (E:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm1E (E:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtgssrktytfdmvfgastkqidv
    yrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlh
    qifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikglee
    itvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkvkigklnlvdlagse
    nininqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispaslnle
    etlstleyahraknilnkpevnq