PDB entry 2glz

View 2glz on RCSB PDB site
Description: Crystal structure of a formylmethanofuran dehydrogenase subunit e-like protein (dhaf_2992) from desulfitobacterium hafniense dcb-2 at 1.45 A resolution
Class: metal binding protein
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, metal binding protein
Deposited on 2006-04-05, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.173
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: similar to Formylmethanofuran dehydrogenase subunit E
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: ZP_01368882.1
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00560742
      • modified residue (36)
      • modified residue (82)
    Domains in SCOPe 2.08: d2glza1
  • Chain 'B':
    Compound: similar to Formylmethanofuran dehydrogenase subunit E
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: ZP_01368882.1
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00560742
      • modified residue (36)
      • modified residue (82)
    Domains in SCOPe 2.08: d2glzb_
  • Heterogens: ZN, NI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2glzA (A:)
    gmcvektpwelvidfhghtcpdialgyriaqlaqremgirpapdseclvkaytqscalda
    iqvlnkatigrhaliieethrymyqfhftgtqdihqftvspavldhletlrhpdlsprer
    qnkvlegvqyvltleesafchydkipgqlskiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glzA (A:)
    vektpwelvidfhghtcpdialgyriaqlaqremgirpapdseclvkaytqscaldaiqv
    lnkatigrhaliieethrymyqfhftgtqdihqftvspavldhletlrhpdlsprerqnk
    vlegvqyvltleesafchydkipgqlski
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2glzB (B:)
    gmcvektpwelvidfhghtcpdialgyriaqlaqremgirpapdseclvkaytqscalda
    iqvlnkatigrhaliieethrymyqfhftgtqdihqftvspavldhletlrhpdlsprer
    qnkvlegvqyvltleesafchydkipgqlskiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glzB (B:)
    ektpwelvidfhghtcpdialgyriaqlaqremgirpapdseclvkaytqscaldaiqvl
    nkatigrhaliieethrymyqfhftgtqdihqftvspavldhletlrhpdlsprerqnkv
    legvqyvltleesafchydkipgqlski