PDB entry 2gls

View 2gls on RCSB PDB site
Description: refined atomic model of glutamine synthetase at 3.5 angstroms resolution
Class: ligase(amide synthetase)
Keywords: ligase(amide synthetase)
Deposited on 1989-05-19, released 1989-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.258
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsa1, d2glsa2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsb1, d2glsb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsc1, d2glsc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsd1, d2glsd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glse1, d2glse2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsf1, d2glsf2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsg1, d2glsg2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsh1, d2glsh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsi1, d2glsi2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsj1, d2glsj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsk1, d2glsk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2glsl1, d2glsl2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2glsA (A:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsA (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2glsB (B:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsB (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2glsC (C:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsC (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2glsD (D:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsD (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2glsE (E:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsE (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2glsF (F:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsF (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2glsG (G:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsG (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2glsH (H:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsH (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2glsI (I:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsI (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2glsJ (J:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsJ (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2glsK (K:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsK (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2glsL (L:)
    msaehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkg
    inesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratg
    iadtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggy
    fpvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyk
    yvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyig
    gvikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievr
    fpdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealn
    aldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glsL (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv