PDB entry 2glm

View 2glm on RCSB PDB site
Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(FabZ) from Helicobacter pylori complexed with Compound 2
Class: Lyase
Keywords: FabZ complex, Lyase
Deposited on 2006-04-05, released 2007-03-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:102617]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2glma_
  • Chain 'B':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:102617]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2glmb_
  • Chain 'C':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:102617]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2glmc_
  • Chain 'D':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:102617]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2glmd_
  • Chain 'E':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:102617]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2glme_
  • Chain 'F':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:102617]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2glmf_
  • Heterogens: CL, BEN, SCB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2glmA (A:)
    mrgshhhhhhgsmeqshqnlqsqffiehilqilphrypmllvdritelqanqkivaykni
    tfnedvfnghfpnkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvk
    fripvtpgdrleyhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glmA (A:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2glmB (B:)
    mrgshhhhhhgsmeqshqnlqsqffiehilqilphrypmllvdritelqanqkivaykni
    tfnedvfnghfpnkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvk
    fripvtpgdrleyhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glmB (B:)
    qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
    livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
    kgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2glmC (C:)
    mrgshhhhhhgsmeqshqnlqsqffiehilqilphrypmllvdritelqanqkivaykni
    tfnedvfnghfpnkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvk
    fripvtpgdrleyhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glmC (C:)
    qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
    livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
    kgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2glmD (D:)
    mrgshhhhhhgsmeqshqnlqsqffiehilqilphrypmllvdritelqanqkivaykni
    tfnedvfnghfpnkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvk
    fripvtpgdrleyhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glmD (D:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2glmE (E:)
    mrgshhhhhhgsmeqshqnlqsqffiehilqilphrypmllvdritelqanqkivaykni
    tfnedvfnghfpnkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvk
    fripvtpgdrleyhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glmE (E:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2glmF (F:)
    mrgshhhhhhgsmeqshqnlqsqffiehilqilphrypmllvdritelqanqkivaykni
    tfnedvfnghfpnkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvk
    fripvtpgdrleyhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >2glmF (F:)
    qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli
    vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg
    miwqvggtaqvdgkvvaeaelkamiae