PDB entry 2glk

View 2glk on RCSB PDB site
Description: High-resolution study of D-Xylose isomerase, 0.94A resolution.
Class: isomerase
Keywords: TIM barrel, beta-alpha-barrels, two metal binding sites, ISOMERASE
Deposited on 2006-04-05, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 0.9400000000000001 Å
R-factor: N/A
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces rubiginosus [TaxId:1929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24300 (1-387)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d2glka_
  • Heterogens: MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2glkA (A:)
    mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
    fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
    rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
    epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
    lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
    asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
    dvdaaaargmaferldqlamdhllgarg