PDB entry 2gl7

View 2gl7 on RCSB PDB site
Description: Crystal Structure of a beta-catenin/BCL9/Tcf4 complex
Class: transcription
Keywords: protein complex, armadillo repeat
Deposited on 2006-04-04, released 2006-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Gene: CTNNB1, CTNNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35222
      • engineered (5)
    Domains in SCOP 1.73: d2gl7a1
  • Chain 'B':
    Compound: transcription factor 7-like 2
    Species: HOMO SAPIENS
    Gene: TCF7L2, TCF4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: B-cell lymphoma 9 protein
    Species: HOMO SAPIENS
    Gene: BCL9
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Gene: CTNNB1, CTNNB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gl7d1
  • Chain 'E':
    Compound: transcription factor 7-like 2
    Species: HOMO SAPIENS
    Gene: TCF7L2, TCF4
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: B-cell lymphoma 9 protein
    Species: HOMO SAPIENS
    Gene: BCL9
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gl7A (A:)
    snlineqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvs
    aivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyai
    ttlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliil
    asggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqr
    lvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkm
    mvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvk
    llhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggt
    qqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaag
    vlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsedkpqdykkrlsv
    eltsslfrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl7A (A:)
    eqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrt
    mqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhn
    lllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggp
    qalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnc
    lwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqv
    ggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpp
    shwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeive
    gctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeai
    eaegatapltellhsrnegvatyaaavlfrms
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gl7D (D:)
    snlineqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvs
    aivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyai
    ttlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliil
    asggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqr
    lvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkm
    mvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvk
    llhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggt
    qqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaag
    vlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsedkpqdykkrlsv
    eltsslfrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl7D (D:)
    elatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntn
    dvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhq
    egakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvn
    imrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlr
    nlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiea
    lvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwpl
    ikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeivegctga
    lhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaega
    tapltellhsrnegvatyaaavlfrm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.