PDB entry 2gl5

View 2gl5 on RCSB PDB site
Description: Crystal Structure of Putative Dehydratase from Salmonella Thyphimurium
Class: structural genomics, unknown function
Keywords: DEHYDRATASE, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, NYSGXRC, New York SGX Research Center for Structural Genomics STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2006-04-04, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative dehydratase protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM2273
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZNH1 (3-401)
      • cloning artifact (1-2)
      • engineered (144)
    Domains in SCOPe 2.08: d2gl5a1, d2gl5a2, d2gl5a3
  • Chain 'B':
    Compound: putative dehydratase protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM2273
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZNH1 (3-401)
      • cloning artifact (1-2)
      • engineered (144)
    Domains in SCOPe 2.08: d2gl5b1, d2gl5b2, d2gl5b3
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gl5A (A:)
    mslkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiir
    dlaplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyq
    llggktneklrtyasqlqfgwgdknhilvtpeeyaeaaraalddgydaikvdpleidrng
    ddcvfqnrnrnysgllladqlkmgeariaamreamgddadiiveihsllgtnsaiqfaka
    iekyriflyeepihplnsdnmqkvsrsttipiatgersytrwgyrellekqsiavaqpdl
    clcggitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnfiihehhtnamkas
    irelcthdyqpengyyvapeqpglgqelndevvkeylayvikeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl5A (A:)
    slkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiird
    laplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyql
    lggktneklrtyasqlqfgwgdknhilvtpeeyaeaaraalddgydaikvdpleidrngd
    dcvfqnrnrnysgllladqlkmgeariaamreamgddadiiveihsllgtnsaiqfakai
    ekyriflyeepihplnsdnmqkvsrsttipiatgersytrwgyrellekqsiavaqpdlc
    lcggitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnfiihehhtnamkasi
    relcthdyqpengyyvapeqpglgqelndevvkeylayvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gl5B (B:)
    mslkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiir
    dlaplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyq
    llggktneklrtyasqlqfgwgdknhilvtpeeyaeaaraalddgydaikvdpleidrng
    ddcvfqnrnrnysgllladqlkmgeariaamreamgddadiiveihsllgtnsaiqfaka
    iekyriflyeepihplnsdnmqkvsrsttipiatgersytrwgyrellekqsiavaqpdl
    clcggitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnfiihehhtnamkas
    irelcthdyqpengyyvapeqpglgqelndevvkeylayvikeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl5B (B:)
    slkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiird
    laplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyql
    lggktneklrtyasqlqfgwgdknhilvtpeeyaeaaraalddgydaikvdpleidrngd
    dcvfqnrnrnysgllladqlkmgeariaamreamgddadiiveihsllgtnsaiqfakai
    ekyriflyeepihplnsdnmqkvsrsttipiatgersytrwgyrellekqsiavaqpdlc
    lcggitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnfiihehhtnamkasi
    relcthdyqpengyyvapeqpglgqelndevvkeylayvik