PDB entry 2gl3

View 2gl3 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis trHbN, TyrB10Phe GlnE11Val mutant
Class: oxygen storage/transport
Keywords: truncated hemoglobin; mutant, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2006-04-04, released 2006-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin-like protein HbN
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A592
      • engineered (32)
      • engineered (57)
    Domains in SCOPe 2.06: d2gl3a_
  • Chain 'B':
    Compound: Hemoglobin-like protein HbN
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A592
      • engineered (32)
      • engineered (57)
    Domains in SCOPe 2.06: d2gl3b_
  • Heterogens: NA, PO4, CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gl3A (A:)
    mgllsrlrkrepisiydkiggheaievvvedffvrvladdqlsaffsgtnmsrlkgkvve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl3A (A:)
    gllsrlrkrepisiydkiggheaievvvedffvrvladdqlsaffsgtnmsrlkgkvvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvtsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gl3B (B:)
    mgllsrlrkrepisiydkiggheaievvvedffvrvladdqlsaffsgtnmsrlkgkvve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl3B (B:)
    gllsrlrkrepisiydkiggheaievvvedffvrvladdqlsaffsgtnmsrlkgkvvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvts