PDB entry 2gkt

View 2gkt on RCSB PDB site
Description: Crystal structure of the P14'-Ala32 variant of the N-terminally truncated OMTKY3-del(1-5)
Class: hydrolase inhibitor
Keywords: reactive-site loop, alpha-helix, antiparallel beta-sheet, HYDROLASE INHIBITOR
Deposited on 2006-04-03, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.132
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'I':
  Compound: Ovomucoid
  Species: Meleagris gallopavo [TaxId:9103]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68390 (0-50)
    • engineered (26)
  Domains in SCOPe 2.08: d2gkti_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gktI (I:)
  vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc