PDB entry 2gko

View 2gko on RCSB PDB site
Description: S41 Psychrophilic Protease
Class: hydrolase
Keywords: s41 protease TA41 psychrophilic, Hydrolase
Deposited on 2006-04-03, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: microbial serine proteinases; subtilisin
    Species: Bacillus subtilis [TaxId:1423]
    Gene: s41
    Database cross-references and differences (RAF-indexed):
    • GB CAA45096 (0-308)
    Domains in SCOPe 2.07: d2gkoa_
  • Heterogens: CA, NA, PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gkoA (A:)
    aasqstpwgikaiynnsnltstsggaginiavldtgvntnhpdlsnnveqckdftvgtnf
    tdnsctdrqghgthvagsalanggtgsgvygvapeadlwaykvlgddgsgyaddiaeair
    hagdqatalntkvvinmslgssgesslitnavdyaydkgvliiaaagnsgpkpgsigypg
    alvnavavaalentiqngtyrvadfssrghkrtagdyviqkgdveisapgaavystwfdg
    gyatisgtsmasphaaglaakiwaqspaasnvdvrgelqtrasvndilsgnsagsgddia
    sgfgfakvq