PDB entry 2gke

View 2gke on RCSB PDB site
Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor LL-AziDAP
Class: Isomerase
Keywords: enzyme-inhibitor complex, covalently bound inhibitor, Isomerase
Deposited on 2006-04-01, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.139
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: DAPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gkea1, d2gkea2
  • Heterogens: ZDP, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gkeA (A:)
    mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
    rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
    piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
    sherfpervnagfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqv
    dlpggslmiewngvghplymtgeathiydgfitl