PDB entry 2gkc

View 2gkc on RCSB PDB site
Description: Structural insight into self-sacrifice mechanism of enediyne resistance
Class: ligand binding protein
Keywords: START Domain, LIGAND BINDING PROTEIN
Deposited on 2006-04-01, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalC
    Species: Micromonospora echinospora [TaxId:1877]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gkca_
  • Heterogens: CCG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gkcA (A:)
    nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
    eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
    mgtkhakrvrngmdkgwptilqsfqdkideegakk