PDB entry 2gjy

View 2gjy on RCSB PDB site
Description: NMR Solution Structure of Tensin1 PTB Domain
Class: cell adhesion
Keywords: focal adhesion beta sandwich, CELL ADHESION
Deposited on 2006-03-31, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tensin
  Species: Gallus gallus [TaxId:9031]
  Gene: TNS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04205 (4-143)
    • cloning artifact (0-3)
  Domains in SCOPe 2.08: d2gjya1, d2gjya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gjyA (A:)
  gshmgaacnvlfinsvemesltgpqaiskavaetlvadptptativhfkvsaqgitltdn
  qrklffrrhyplntvtfcdldpqerkwtktdgsgpaklfgfvarkqgsttdnvchlfael
  dpdqpaaaivnfvsrvmlgsgqkr