PDB entry 2gjx

View 2gjx on RCSB PDB site
Description: Crystallographic structure of human beta-Hexosaminidase A
Class: hydrolase
Keywords: beta-hexosaminidase A, glycosidase, Tay-Sachs disease, GM2 ganglisode, Tim barrel, HYDROLASE
Deposited on 2006-03-31, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxa1, d2gjxa2
  • Chain 'B':
    Compound: beta-hexosaminidase beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxb1, d2gjxb2
  • Chain 'C':
    Compound: beta-hexosaminidase beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxc1, d2gjxc2
  • Chain 'D':
    Compound: Beta-hexosaminidase alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxd1, d2gjxd2
  • Chain 'E':
    Compound: Beta-hexosaminidase alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxe1, d2gjxe2
  • Chain 'F':
    Compound: beta-hexosaminidase beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxf1, d2gjxf2
  • Chain 'G':
    Compound: beta-hexosaminidase beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxg1, d2gjxg2
  • Chain 'H':
    Compound: Beta-hexosaminidase alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gjxh1, d2gjxh2
  • Heterogens: NAG, BMA, SO4, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gjxA (A:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
    ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
    sqlvwksaegtffinkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfh
    whlvddpsfpyesftfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpgh
    tlswgpgipglltpcysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggd
    evdftcwksnpeiqdfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvk
    iqpdtiiqvwredipvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplaf
    egtpeqkalviggeacmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlsh
    frcellrrgvqaqplnvgfceqefeqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxA (A:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
    vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
    nkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesf
    tfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltp
    cysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiq
    dfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredi
    pvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalvigge
    acmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqp
    lnvgfceqefeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gjxB (B:)
    akpgpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfy
    kwhhepaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgal
    rgletfsqlvyqdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafn
    kfnvlhwhivddqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpef
    dtpghtlswgkgqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfi
    hlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevf
    ddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepl
    dfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrl
    trhrcrmvergiaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxB (B:)
    palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
    lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
    tinestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyq
    sitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdllt
    pcysdsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmr
    qkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypee
    lsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgey
    vdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gjxC (C:)
    akpgpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfy
    kwhhepaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgal
    rgletfsqlvyqdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafn
    kfnvlhwhivddqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpef
    dtpghtlswgkgqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfi
    hlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevf
    ddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepl
    dfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrl
    trhrcrmvergiaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxC (C:)
    palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
    lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
    tinestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyq
    sitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdllt
    pcysldsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfm
    rqkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaype
    elsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwge
    yvdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagyc
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gjxD (D:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
    ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
    sqlvwksaegtffinkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfh
    whlvddpsfpyesftfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpgh
    tlswgpgipglltpcysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggd
    evdftcwksnpeiqdfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvk
    iqpdtiiqvwredipvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplaf
    egtpeqkalviggeacmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlsh
    frcellrrgvqaqplnvgfceqefeqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxD (D:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
    vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
    nkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesf
    tfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltp
    cysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiq
    dfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredi
    pvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalvigge
    acmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqp
    lnvgfceqefeq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gjxE (E:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
    ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
    sqlvwksaegtffinkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfh
    whlvddpsfpyesftfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpgh
    tlswgpgipglltpcysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggd
    evdftcwksnpeiqdfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvk
    iqpdtiiqvwredipvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplaf
    egtpeqkalviggeacmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlsh
    frcellrrgvqaqplnvgfceqefeqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxE (E:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
    vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
    nkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesf
    tfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltp
    cysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiq
    dfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredi
    pvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalvigge
    acmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqp
    lnvgfceqefeq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gjxF (F:)
    akpgpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfy
    kwhhepaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgal
    rgletfsqlvyqdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafn
    kfnvlhwhivddqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpef
    dtpghtlswgkgqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfi
    hlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevf
    ddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepl
    dfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrl
    trhrcrmvergiaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxF (F:)
    palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
    lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
    tinestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyq
    sitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdllt
    pcysdsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmr
    qkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypee
    lsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgey
    vdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2gjxG (G:)
    akpgpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfy
    kwhhepaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgal
    rgletfsqlvyqdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafn
    kfnvlhwhivddqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpef
    dtpghtlswgkgqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfi
    hlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevf
    ddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepl
    dfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrl
    trhrcrmvergiaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxG (G:)
    palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
    lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
    tinestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyq
    sitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdllt
    pcysdsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmr
    qkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypee
    lsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgey
    vdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2gjxH (H:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
    ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
    sqlvwksaegtffinkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfh
    whlvddpsfpyesftfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpgh
    tlswgpgipglltpcysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggd
    evdftcwksnpeiqdfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvk
    iqpdtiiqvwredipvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplaf
    egtpeqkalviggeacmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlsh
    frcellrrgvqaqplnvgfceqefeqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjxH (H:)
    lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
    vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
    nkteiedfprfphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesf
    tfpelmrkgsynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltp
    cysgsepsgtfgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiq
    dfmrkkgfgedfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredi
    pvnymkelelvtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalvigge
    acmwgeyvdntnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqp
    lnvgfceqefeq