PDB entry 2gjs

View 2gjs on RCSB PDB site
Description: The crystal structure of human RRAD in complex with GDP
Class: signaling protein
Keywords: RRAD, GDP/GTP binding, GTP hydrolysis, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-03-31, released 2006-04-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein RAD
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gjsa1
  • Chain 'B':
    Compound: GTP-binding protein RAD
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gjsb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gjsA (A:)
    smsdesvykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvyd
    iweqdggrwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnk
    sdlvrsrevsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrdskea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjsA (A:)
    vykvlllgapgvgksalarifggvghtydrsivvdgeeaslmvydiwlpghcmamgdayv
    ivysvtdkgsfekaselrvqlrrarqdvpiilvgnksdlvrsrevsvdegracavvfdck
    fietsaalhhnvqalfegvvrqirlrrdsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gjsB (B:)
    smsdesvykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvyd
    iweqdggrwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnk
    sdlvrsrevsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrdskea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjsB (B:)
    vykvlllgapgvgksalarifggvehtydrsivvdgeeaslmvydimgdayvivysvtdk
    gsfekaselrvqlrrardvpiilvgnksdlvrsrevsvdegracavvfdckfietsaalh
    hnvqalfegvvrqirlrrd