PDB entry 2gjp

View 2gjp on RCSB PDB site
Description: Structure of Bacillus halmapalus alpha-amylase, crystallized with the substrate analogue acarbose and maltose
Class: hydrolase
Keywords: alpha-amylase, maltose binding site, bacillus halmapalus, HYDROLASE
Deposited on 2006-03-31, released 2006-09-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Bacillus halmapalus [TaxId:79882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gjpa1, d2gjpa2
  • Heterogens: MAL, GLC, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gjpA (A:)
    hhmgtngtmmqyfewhlpndgqhwnrlrddasnlrnrgitaiwippawkgtsqndvgyga
    ydlydlgefnqkgtvrtkygtrsqlesaihalknngvqvygdvvmnhkggadatenvlav
    evnpnnrnqeisgdytieawtkfdfpgrgntysdfkwrwyhfdgvdwdqsrqfqnriykf
    rgdgkawdwevdsengnydylmyadvdmdhpevvnelrrwgewytntlnldgfridavkh
    ikysftrdwlthvrnatgkemfavaefwkndlgalenylnktnwnhsvfdvplhynlyna
    snsggnydmakllngtvvqkhpmhavtfvdnhdsqpgeslesfvqewfkplayaliltre
    qgypsvfygdyygipthsvpamkakidpilearqnfaygtqhdyfdhhniigwtregntt
    hpnsglatimsdgpggekwmyvgqnkagqvwhditgnkpgtvtinadgwanfsvnggsvs
    iwvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjpA (A:)
    tngtmmqyfewhlpndgqhwnrlrddasnlrnrgitaiwippawkgtsqndvgygaydly
    dlgefnqkgtvrtkygtrsqlesaihalknngvqvygdvvmnhkggadatenvlavevnp
    nnrnqeisgdytieawtkfdfpgrgntysdfkwrwyhfdgvdwdqsrqfqnriykfrgdg
    kawdwevdsengnydylmyadvdmdhpevvnelrrwgewytntlnldgfridavkhikys
    ftrdwlthvrnatgkemfavaefwkndlgalenylnktnwnhsvfdvplhynlynasnsg
    gnydmakllngtvvqkhpmhavtfvdnhdsqpgeslesfvqewfkplayaliltreqgyp
    svfygdyygipthsvpamkakidpilearqnfaygtqhdyfdhhniigwtregntthpns
    glatimsdgpggekwmyvgqnkagqvwhditgnkpgtvtinadgwanfsvnggsvsiwvk
    r