PDB entry 2gj4

View 2gj4 on RCSB PDB site
Description: Structure of rabbit muscle glycogen phosphorylase in complex with ligand
Class: transferase
Keywords: glycogen phosphorylase, transferase
Deposited on 2006-03-30, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gj4a_
  • Heterogens: SO4, PLR, 2TH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gj4A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
    ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
    caytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
    eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
    lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
    eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaap
    gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
    easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
    ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
    knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj4A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapng
    yiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksnfdafpdk
    vaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvhll
    etllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagshav
    ngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeeyi
    sdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkrihe
    ykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvnh
    dpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigtm
    dganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffsp
    kqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkfs
    sdrtiaqyareiwgvepsrqrlp