PDB entry 2gix

View 2gix on RCSB PDB site
Description: Cytoplasmic Domain Structure of Kir2.1 containing Andersen's Mutation R218Q and Rescue Mutation T309K
Class: metal transport
Keywords: Cytoplasmic Domains of Kir2.1, Andersen's Mutation, METAL TRANSPORT
Deposited on 2006-03-29, released 2006-07-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35561 (25-End)
      • engineered (54)
      • engineered (145)
      • cloning artifact (1-3)
    • Uniprot P35561 (4-24)
    Domains in SCOPe 2.05: d2gixa_
  • Chain 'B':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35561 (25-End)
      • engineered (54)
      • engineered (145)
      • cloning artifact (1-3)
    • Uniprot P35561 (4-24)
    Domains in SCOPe 2.05: d2gixb_
  • Chain 'C':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35561 (25-End)
      • engineered (54)
      • engineered (145)
      • cloning artifact (1-3)
    • Uniprot P35561 (4-24)
    Domains in SCOPe 2.05: d2gixc_
  • Chain 'D':
    Compound: Inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj2, Irk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35561 (25-End)
      • engineered (54)
      • engineered (145)
      • cloning artifact (1-3)
    • Uniprot P35561 (4-24)
    Domains in SCOPe 2.05: d2gixd_
  • Heterogens: K, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gixA (A:)
    gshgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlv
    eahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydls
    kqdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysr
    fhktyevpntplcsardlaekkyilsna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gixA (A:)
    shgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlve
    ahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlsk
    qdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrf
    hktyevpntplcsardlaekkyilsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gixB (B:)
    gshgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlv
    eahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydls
    kqdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysr
    fhktyevpntplcsardlaekkyilsna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gixB (B:)
    shgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlve
    ahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlsk
    qdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrf
    hktyevpntplcsardlaekk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gixC (C:)
    gshgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlv
    eahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydls
    kqdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysr
    fhktyevpntplcsardlaekkyilsna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gixC (C:)
    shgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlve
    ahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlsk
    qdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrf
    hktyevpntplcsardlaekkyilsn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gixD (D:)
    gshgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlv
    eahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydls
    kqdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysr
    fhktyevpntplcsardlaekkyilsna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gixD (D:)
    shgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlve
    ahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlsk
    qdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrf
    hktyevpntplcsardlaekkyils