PDB entry 2giu

View 2giu on RCSB PDB site
Description: Human estrogen receptor beta ligand-binding domain in complex with compound 45
Class: transcription regulator
Keywords: nuclear receptor, transcription factor, er-beta, agonist, transcription regulator
Deposited on 2006-03-29, released 2006-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2giua_
  • Heterogens: FBR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2giuA (A:)
    ldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgf
    velslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdm
    llattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvw
    viaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahv
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >2giuA (A:)
    ldalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslf
    dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcegileifdmllattsr
    frelklqhkeylcvkamillnssmyplvadssrklahllnavtdalvwviaksgissqqq
    smrlanllmllshvrhasnkgmehllnmvvpvydlllemlnahvl