PDB entry 2gin

View 2gin on RCSB PDB site
Description: X-ray structure of the wt allene oxide cyclase 2 from arabidopsis thaliana
Class: isomerase
Keywords: beta barrel, isomerase
Deposited on 2006-03-29, released 2006-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gina_
  • Chain 'B':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ginb_
  • Chain 'C':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ginc_
  • Chain 'D':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gind_
  • Chain 'E':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gine_
  • Chain 'F':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ginf_
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ginA (A:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ginA (A:)
    vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
    hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
    yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ginB (B:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ginB (B:)
    vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
    hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
    yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ginC (C:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ginC (C:)
    vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
    hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
    yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ginD (D:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ginD (D:)
    vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
    hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
    yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ginE (E:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ginE (E:)
    vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
    hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
    yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ginF (F:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ginF (F:)
    vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
    hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
    yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn