PDB entry 2gih

View 2gih on RCSB PDB site
Description: Q138F HincII bound to cognate DNA GTCGAC and Ca2+
Class: hydrolase/DNA
Keywords: protein DNA complex, indirect readout, DNA intercalation, endonuclease, HYDROLASE/DNA COMPLEX
Deposited on 2006-03-28, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-256)
      • conflict (128)
      • engineered (136)
      • conflict (171)
    Domains in SCOPe 2.08: d2giha_
  • Chain 'B':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-256)
      • conflict (128)
      • engineered (136)
      • conflict (171)
    Domains in SCOPe 2.08: d2gihb_
  • Chain 'E':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*gp*c)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*gp*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gihA (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gihB (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gihB (B:)
    sfikpiyqdinsiligqkvkrsghaagepfeklvykflkenlsdltfkqyeylndlfmkn
    paiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelld
    vktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsf
    aelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismid
    kfvkpfkkyil
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.