PDB entry 2gid

View 2gid on RCSB PDB site
Description: Crystal structures of trypanosoma bruciei MRP1/MRP2
Class: translation
Keywords: T. brucei; guide RNA; matchmaking; RNA editing, TRANSLATION
Deposited on 2006-03-28, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.233
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial RNA-binding protein 2
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q952G2
      • modified residue (80)
      • modified residue (95)
      • modified residue (174)
    Domains in SCOPe 2.07: d2gida1
  • Chain 'B':
    Compound: mitochondrial RNA-binding protein 1
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90629
      • conflict (23)
      • modified residue (26)
      • modified residue (89)
      • modified residue (119)
    Domains in SCOPe 2.07: d2gidb1
  • Chain 'D':
    Compound: mitochondrial RNA-binding protein 1
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90629
      • conflict (23)
      • modified residue (26)
      • modified residue (89)
      • modified residue (119)
    Domains in SCOPe 2.07: d2gidd1
  • Chain 'G':
    Compound: mitochondrial RNA-binding protein 2
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q952G2
      • modified residue (80)
      • modified residue (95)
      • modified residue (174)
    Domains in SCOPe 2.07: d2gidg1
  • Chain 'H':
    Compound: mitochondrial RNA-binding protein 2
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q952G2
      • modified residue (80)
      • modified residue (95)
      • modified residue (174)
    Domains in SCOPe 2.07: d2gidh1
  • Chain 'J':
    Compound: mitochondrial RNA-binding protein 1
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90629
      • conflict (23)
      • modified residue (26)
      • modified residue (89)
      • modified residue (119)
    Domains in SCOPe 2.07: d2gidj1
  • Chain 'K':
    Compound: mitochondrial RNA-binding protein 1
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90629
      • conflict (23)
      • modified residue (26)
      • modified residue (89)
      • modified residue (119)
    Domains in SCOPe 2.07: d2gidk1
  • Chain 'P':
    Compound: mitochondrial RNA-binding protein 2
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q952G2
      • modified residue (80)
      • modified residue (95)
      • modified residue (174)
    Domains in SCOPe 2.07: d2gidp1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gidA (A:)
    eaasssdadgkevgssgegnratggkwrrpslaqqrarraqlppafdvvhwndedisrgh
    llrvlhrdtfvvldyhrqarmlteegnkaervvsvmlpavytarflavlegrsekvevhs
    rytnatftpnpaapytftlkctstrpaqqkqqvageegdetfewtvefdvaeslmlqrfl
    tqalhyntgfartsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidA (A:)
    slaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteegnkae
    rvvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrpdetf
    ewtvefdvaeslmlqrfltqalhyntgfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gidB (B:)
    astfsgvqslpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfd
    adrrisvrlrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrm
    edwsvkfdnhfavtlehflesaldesfgfrqhyatraaeggekiaatssaeggarrkrsv
    sdtsryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidB (B:)
    slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
    lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
    nhfavtlehflesaldesfgfrqhya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gidD (D:)
    astfsgvqslpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfd
    adrrisvrlrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrm
    edwsvkfdnhfavtlehflesaldesfgfrqhyatraaeggekiaatssaeggarrkrsv
    sdtsryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidD (D:)
    slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
    lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
    nhfavtlehflesaldesfgfrqhya
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2gidG (G:)
    eaasssdadgkevgssgegnratggkwrrpslaqqrarraqlppafdvvhwndedisrgh
    llrvlhrdtfvvldyhrqarmlteegnkaervvsvmlpavytarflavlegrsekvevhs
    rytnatftpnpaapytftlkctstrpaqqkqqvageegdetfewtvefdvaeslmlqrfl
    tqalhyntgfartsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidG (G:)
    pslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteegnka
    ervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrpdet
    fewtvefdvaeslmlqrfltqalhyntgfar
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2gidH (H:)
    eaasssdadgkevgssgegnratggkwrrpslaqqrarraqlppafdvvhwndedisrgh
    llrvlhrdtfvvldyhrqarmlteegnkaervvsvmlpavytarflavlegrsekvevhs
    rytnatftpnpaapytftlkctstrpaqqkqqvageegdetfewtvefdvaeslmlqrfl
    tqalhyntgfartsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidH (H:)
    pslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteegnka
    ervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrpdet
    fewtvefdvaeslmlqrfltqalhyntgfar
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2gidJ (J:)
    astfsgvqslpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfd
    adrrisvrlrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrm
    edwsvkfdnhfavtlehflesaldesfgfrqhyatraaeggekiaatssaeggarrkrsv
    sdtsryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidJ (J:)
    slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
    lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
    nhfavtlehflesaldesfgfrqhya
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2gidK (K:)
    astfsgvqslpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfd
    adrrisvrlrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrm
    edwsvkfdnhfavtlehflesaldesfgfrqhyatraaeggekiaatssaeggarrkrsv
    sdtsryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidK (K:)
    slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
    lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
    nhfavtlehflesaldesfgfrqhya
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2gidP (P:)
    eaasssdadgkevgssgegnratggkwrrpslaqqrarraqlppafdvvhwndedisrgh
    llrvlhrdtfvvldyhrqarmlteegnkaervvsvmlpavytarflavlegrsekvevhs
    rytnatftpnpaapytftlkctstrpaqqkqqvageegdetfewtvefdvaeslmlqrfl
    tqalhyntgfartsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gidP (P:)
    pslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteegnka
    ervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrpdet
    fewtvefdvaeslmlqrfltqalhyntgfar