PDB entry 2gic

View 2gic on RCSB PDB site
Description: Crystal Structure of a vesicular stomatitis virus nucleocapsid-RNA complex
Class: virus/viral protein/RNA
Keywords: nucleocapsid, protein-rna complex, negative strand virus, VIRUS-VIRAL PROTEIN-RNA COMPLEX
Deposited on 2006-03-28, released 2006-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gica1
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gicb_
  • Chain 'C':
    Compound: nucleocapsid protein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gicc_
  • Chain 'D':
    Compound: nucleocapsid protein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gicd_
  • Chain 'E':
    Compound: nucleocapsid protein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gice_
  • Chain 'R':
    Compound: 45-mer
  • Heterogens: IUM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gicA (A:)
    msvtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglk
    sgnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdg
    vsdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrd
    ifdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgm
    stedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfw
    gqltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdds
    tgglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksef
    dk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gicA (A:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
    gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gicB (B:)
    msvtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglk
    sgnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdg
    vsdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrd
    ifdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgm
    stedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfw
    gqltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdds
    tgglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksef
    dk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gicB (B:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdttn
    appqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefdk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gicC (C:)
    msvtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglk
    sgnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdg
    vsdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrd
    ifdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgm
    stedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfw
    gqltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdds
    tgglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksef
    dk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gicC (C:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytptnap
    pqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefdk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gicD (D:)
    msvtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglk
    sgnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdg
    vsdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrd
    ifdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgm
    stedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfw
    gqltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdds
    tgglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksef
    dk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gicD (D:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdltt
    nappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefdk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gicE (E:)
    msvtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglk
    sgnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdg
    vsdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrd
    ifdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgm
    stedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfw
    gqltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdds
    tgglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksef
    dk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gicE (E:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
    gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
    k
    

  • Chain 'R':
    No sequence available.