PDB entry 2gib

View 2gib on RCSB PDB site
Description: Crystal structure of the SARS coronavirus nucleocapsid protein dimerization domain
Class: virus/viral protein
Keywords: SARS, nucleocapsid, dimer
Deposited on 2006-03-28, released 2006-04-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: Human SARS coronavirus
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2giba1
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: Human SARS coronavirus
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gibb1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gibA (A:)
    sanvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaffgmsrigmevtp
    sgtwltyhgaiklddkdpqfkdnvillnkhidayktfpptepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gibA (A:)
    nvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaffgmsrigmevtpsg
    twltyhgaiklddkdpqfkdnvillnkhidayktfpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gibB (B:)
    sanvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaffgmsrigmevtp
    sgtwltyhgaiklddkdpqfkdnvillnkhidayktfpptepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gibB (B:)
    afgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaffgmsrigmevtpsgtwlt
    yhgaiklddkdpqfkdnvillnkhidayktfpptep