PDB entry 2gi7

View 2gi7 on RCSB PDB site
Description: Crystal structure of human platelet Glycoprotein VI (GPVI)
Class: blood clotting, cell adhesion
Keywords: Ig-like domains, BLOOD CLOTTING, CELL ADHESION
Deposited on 2006-03-28, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GPVI protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed):
    • GB AAH69485 (Start-183)
    Domains in SCOPe 2.07: d2gi7a1, d2gi7a2
  • Chain 'B':
    Compound: GPVI protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed):
    • GB AAH69485 (1-183)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2gi7b1, d2gi7b2, d2gi7b3
  • Heterogens: SO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gi7A (A:)
    gqsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamk
    rslagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgpavssggdvtlqcqtryg
    fdqfalykegdpapyknperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdple
    lvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gi7A (A:)
    sgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamkrs
    lagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgpavssggdvtlqcqtrygfd
    qfalykegdpapyknperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelv
    vt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gi7B (B:)
    gqsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamk
    rslagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgpavssggdvtlqcqtryg
    fdqfalykegdpapyknperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdple
    lvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gi7B (B:)
    gqsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamk
    rslagryrcsyqngslwslpsdqlelvatgvfakpslsagdvtlqcqtrygfdqfalyke
    gerwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvt