PDB entry 2ghy

View 2ghy on RCSB PDB site
Description: Novel Crystal Form of the ColE1 Rom Protein
Class: transcription
Keywords: RNA one modulator protein, kissing hairpins, structural packing, HIV-1, TRANSCRIPTION
Deposited on 2006-03-28, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ghya_
  • Chain 'B':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ghyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ghyA (A:)
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfgddg
enl

    Sequence, based on observed residues (ATOM records): (download) 
    >2ghyA (A:)
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ghyB (B:)
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfgddg
enl

    Sequence, based on observed residues (ATOM records): (download) 
    >2ghyB (B:)
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfg