PDB entry 2ghw

View 2ghw on RCSB PDB site
Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R
Class: virus/viral protein/antibiotic
Keywords: SARS, S protein, neutralizing antibody, VIRUS/VIRAL PROTEIN/ANTIBIOTIC COMPLEX
Deposited on 2006-03-27, released 2006-09-19
The last revision prior to the SCOP 1.75 freeze date was dated 2008-07-08, with a file datestamp of 2008-07-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.251
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ghwa1
  • Chain 'B':
    Compound: anti-sars scFv antibody, 80R
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOP 1.75: d2ghwb1, d2ghwb2
  • Chain 'C':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ghwc1
  • Chain 'D':
    Compound: anti-sars scFv antibody, 80R
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOP 1.75: d2ghwd1, d2ghwd2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ghwA (A:)
    madpnitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatk
    lndlcfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatst
    gnynykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqp
    yrvvvlsfellnapatvsglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghwA (A:)
    itnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlc
    fsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnyny
    kyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvv
    lsfellnapat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ghwB (B:)
    maevqlvqsgggvvqpgkslrlscaasgfafssyamhwvrqapgkglewvavisydgsnk
    yyadsvkgrftisrdnskntlylqmnslraedtavyycardrsyyldywgqgtlvtvssg
    gggsggggsggggsettltqspatlslspgeratlscrasqsvrsnlawyqqkpgqaprp
    liydastratgipdrfsgsgsgtdftltisrlepedfavyycqqrsnwpptfgqgtkvev
    ksglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghwB (B:)
    evqlvqsgggvvqpgkslrlscaasgfafssyamhwvrqapgkglewvavisydgsnkyy
    adsvkgrftisrdnskntlylqmnslraedtavyycardrsyyldywgqgtlvtvssggs
    ettltqspatlslspgeratlscrasqsvrsnlawyqqkpgqaprpliydastratgipd
    rfsgsgsgtdftltisrlepedfavyycqqrsnwpptfgqgtkvevksglvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ghwC (C:)
    madpnitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatk
    lndlcfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatst
    gnynykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqp
    yrvvvlsfellnapatvsglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghwC (C:)
    nitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndl
    cfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnyn
    ykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvv
    vlsfelln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ghwD (D:)
    maevqlvqsgggvvqpgkslrlscaasgfafssyamhwvrqapgkglewvavisydgsnk
    yyadsvkgrftisrdnskntlylqmnslraedtavyycardrsyyldywgqgtlvtvssg
    gggsggggsggggsettltqspatlslspgeratlscrasqsvrsnlawyqqkpgqaprp
    liydastratgipdrfsgsgsgtdftltisrlepedfavyycqqrsnwpptfgqgtkvev
    ksglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghwD (D:)
    evqlvqsgggvvqpgkslrlscaasgfafssyamhwvrqapgkglewvavisydgsnkyy
    adsvkgrftisrdnskntlylqmnslraedtavyycardrsyyldywgqgtlvtvssset
    tltqspatlslspgeratlscrasqsvrsnlawyqqkpgqaprpliydastratgipdrf
    sgsgsgtdftltisrlepedfavyycqqrsnwpptfgqgtkvevksglvpr